Recombinant Staphylococcus aureus 30S ribosomal protein S5 (rpsE), Unconjugated, E. coli

Catalog Number: BIM-RPC31261
Article Name: Recombinant Staphylococcus aureus 30S ribosomal protein S5 (rpsE), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31261
Supplier Catalog Number: RPC31261
Alternative Catalog Number: BIM-RPC31261-20UG,BIM-RPC31261-100UG,BIM-RPC31261-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Recombinant Staphylococcus aureus 30S ribosomal protein S5 (rpsE) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain Newman). Target Name: 30S ribosomal protein S5 (rpsE) . Accession Number: A6QJ75, rpsE. Expression Region: 1-163aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 24.8kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.8kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE
Target: 30S ribosomal protein S5 (rpsE)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL