Recombinant Rat Transient receptor potential cation channel subfamily A member 1 (Trpa1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31276
Article Name: Recombinant Rat Transient receptor potential cation channel subfamily A member 1 (Trpa1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31276
Supplier Catalog Number: RPC31276
Alternative Catalog Number: BIM-RPC31276-20UG,BIM-RPC31276-100UG,BIM-RPC31276-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Ankyrin-like with transmembrane domains protein 1, Wasabi receptor
Recombinant Rat Transient receptor potential cation channel subfamily A member 1 (Trpa1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Transient receptor potential cation channel subfamily A member 1 (Trpa1) . Accession Number: Q6RI86, Trpa1. Expression Region: 960-1125aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 27.3kda. Target Synonyms: Ankyrin-like with transmembrane domains protein 1, Wasabi receptor Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.3kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI
Target: Transient receptor potential cation channel subfamily A member 1 (Trpa1)