Recombinant Human Relaxin receptor 2 (RXFP2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31281
Article Name: Recombinant Human Relaxin receptor 2 (RXFP2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31281
Supplier Catalog Number: RPC31281
Alternative Catalog Number: BIM-RPC31281-20UG,BIM-RPC31281-100UG,BIM-RPC31281-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: G-protein coupled receptor 106, G-protein coupled receptor affecting testicular descent, Leucine-rich repeat-containing G-protein coupled receptor 8, Relaxin family peptide receptor 2
Recombinant Human Relaxin receptor 2 (RXFP2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Relaxin receptor 2 (RXFP2) . Accession Number: Q8WXD0, RXFP2. Expression Region: 33-158aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 21.1kda. Target Synonyms: G-protein coupled receptor 106, G-protein coupled receptor affecting testicular descent, Leucine-rich repeat-containing G-protein coupled receptor 8, Relaxin family peptide receptor 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21.1kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: FALTQGSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCGDTSGWATIFGTVHGNANSVALTQECFLKQYPQCCDCKETELECVNGDLKSVPMISNNVTLLSLKKNKIHSLPDKVFI
Target: Relaxin receptor 2 (RXFP2)