Recombinant Human Protein mono-ADP-ribosyltransferase PARP12 (PARP12), Unconjugated, E. coli

Catalog Number: BIM-RPC31292
Article Name: Recombinant Human Protein mono-ADP-ribosyltransferase PARP12 (PARP12), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31292
Supplier Catalog Number: RPC31292
Alternative Catalog Number: BIM-RPC31292-20UG,BIM-RPC31292-100UG,BIM-RPC31292-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ADP-ribosyltransferase diphtheria toxin-like 12, ARTD12, Poly [ADP-ribose] polymerase 12, PARP-12, Zinc finger CCCH domain-containing protein 1
Recombinant Human Protein mono-ADP-ribosyltransferase PARP12 (PARP12) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Protein mono-ADP-ribosyltransferase PARP12 (PARP12) . Accession Number: Q9H0J9, PARP12. Expression Region: 1-701aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 86.5kda. Target Synonyms: ADP-ribosyltransferase diphtheria toxin-like 12, ARTD12, Poly [ADP-ribose] polymerase 12, PARP-12, Zinc finger CCCH domain-containing protein 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 86.5kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: MAQAGVVGEVTQVLCAAGGALELPELRRRLRMGLSADALERLLRQRGRFVVAVRAGGAAAAPERVVLAASPLRLCRAHQGSKPGCVGLCAQLHLCRFMVYGACKFLRAGKNCRNSHSLTTEHNLSVLRTHGVDHLSYNELCQLLFQNDPWLLPEICQHYNKGDGPHGSCAFQKQCIKLHICQYFLQGECKFGTSCKRSHDFSNSENLEKLEKLGMSSDLVSRLPTIYRNAHDIKNKSSAPSRVPPLFVPQGTSER
Target: Protein mono-ADP-ribosyltransferase PARP12 (PARP12)