Recombinant Human DNA topoisomerase 1 (TOP1), partial, Unconjugated, Virus

Catalog Number: BIM-RPC31311
Article Name: Recombinant Human DNA topoisomerase 1 (TOP1), partial, Unconjugated, Virus
Biozol Catalog Number: BIM-RPC31311
Supplier Catalog Number: RPC31311
Alternative Catalog Number: BIM-RPC31311-20UG,BIM-RPC31311-100UG,BIM-RPC31311-1MG
Manufacturer: Biomatik Corporation
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: DNA topoisomerase I
Recombinant Human DNA topoisomerase 1 (TOP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Baculovirus. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: DNA topoisomerase 1 (TOP1) . Accession Number: P11387, TOP1. Expression Region: 190-765aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 72.2kda. Target Synonyms: DNA topoisomerase I Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 72.2kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: NKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKY
Target: DNA topoisomerase 1 (TOP1)