Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC31317
Article Name: Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31317
Supplier Catalog Number: RPC31317
Alternative Catalog Number: BIM-RPC31317-20UG,BIM-RPC31317-100UG,BIM-RPC31317-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: AT1AR, AT1BR, Angiotensin II type-1 receptor, AT1 receptor
Recombinant Human Type-1 angiotensin II receptor (AGTR1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Type-1 angiotensin II receptor (AGTR1) . Accession Number: P30556, AGTR1. Expression Region: 297-359aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 12.3kda. Target Synonyms: AT1AR, AT1BR, Angiotensin II type-1 receptor, AT1 receptor Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 12.3kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Target: Type-1 angiotensin II receptor (AGTR1)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL