Recombinant Human Keratin, type II cytoskeletal 2 epidermal (KRT2), Unconjugated, E. coli

Catalog Number: BIM-RPC31319
Article Name: Recombinant Human Keratin, type II cytoskeletal 2 epidermal (KRT2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31319
Supplier Catalog Number: RPC31319
Alternative Catalog Number: BIM-RPC31319-20UG,BIM-RPC31319-100UG,BIM-RPC31319-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cytokeratin-2e, CK-2e, Epithelial keratin-2e, Keratin-2 epidermis, Keratin-2e, K2e, Type-II keratin Kb2
Recombinant Human Keratin, type II cytoskeletal 2 epidermal (KRT2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Keratin, type II cytoskeletal 2 epidermal (KRT2) . Accession Number: P35908, KRT2. Expression Region: 1-639aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 72.9kda. Target Synonyms: Cytokeratin-2e, CK-2e, Epithelial keratin-2e, Keratin-2 epidermis, Keratin-2e, K2e, Type-II keratin Kb2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 72.9kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >90% by SDS-PAGE
Sequence: MSCQISCKSRGRGGGGGGFRGFSSGSAVVSGGSRRSTSSFSCLSRHGGGGGGFGGGGFGSRSLVGLGGTKSISISVAGGGGGFGAAGGFGGRGGGFGGGSSFGGGSGFSGGGFGGGGFGGGRFGGFGGPGGVGGLGGPGGFGPGGYPGGIHEVSVNQSLLQPLNVKVDPEIQNVKAQEREQIKTLNNKFASFIDKVRFLEQQNQVLQTKWELLQQMNVGTRPINLEPIFQGYIDSLKRYLDGLTAERTSQNSELN
Target: Keratin, type II cytoskeletal 2 epidermal (KRT2)