Recombinant Human FAS-associated death domain protein (FADD), Unconjugated, E. coli

Catalog Number: BIM-RPC31323
Article Name: Recombinant Human FAS-associated death domain protein (FADD), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31323
Supplier Catalog Number: RPC31323
Alternative Catalog Number: BIM-RPC31323-20UG,BIM-RPC31323-100UG,BIM-RPC31323-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: FAS-associating death domain-containing protein, Growth-inhibiting gene 3 protein, Mediator of receptor induced toxicity
Recombinant Human FAS-associated death domain protein (FADD) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FAS-associated death domain protein (FADD) . Accession Number: Q13158, FADD. Expression Region: 1-208aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 30.2kda. Target Synonyms: FAS-associating death domain-containing protein, Growth-inhibiting gene 3 protein, Mediator of receptor induced toxicity Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.2kDa
Tag: C-Terminal 6xHis-Tagged
Purity: >85% by SDS-PAGE
Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Target: FAS-associated death domain protein (FADD)