Recombinant Human Keratin, type I cuticular Ha2 (KRT32), Unconjugated, E. coli

Catalog Number: BIM-RPC31324
Article Name: Recombinant Human Keratin, type I cuticular Ha2 (KRT32), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31324
Supplier Catalog Number: RPC31324
Alternative Catalog Number: BIM-RPC31324-20UG,BIM-RPC31324-100UG,BIM-RPC31324-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Hair keratin, type I Ha2, Keratin-32, K32
Recombinant Human Keratin, type I cuticular Ha2 (KRT32) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Keratin, type I cuticular Ha2 (KRT32) . Accession Number: Q14532, KRT32. Expression Region: 1-448aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 57.3kda. Target Synonyms: Hair keratin, type I Ha2, Keratin-32, K32 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 57.3kDa
Tag: C-Terminal 6xHis-Tagged
Purity: >90% by SDS-PAGE
Sequence: MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPASCLSKTYLSSSCQAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQENAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADDFRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGSLRCQLGDRLNIEVDA
Target: Keratin, type I cuticular Ha2 (KRT32)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL