Recombinant Human Cathepsin W (CTSW), Unconjugated, E. coli

Catalog Number: BIM-RPC31362
Article Name: Recombinant Human Cathepsin W (CTSW), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31362
Supplier Catalog Number: RPC31362
Alternative Catalog Number: BIM-RPC31362-20UG,BIM-RPC31362-100UG,BIM-RPC31362-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Lymphopain
Recombinant Human Cathepsin W (CTSW) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Cathepsin W (CTSW) . Accession Number: P56202, CTSW. Expression Region: 128-376aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 33.1kda. Target Synonyms: Lymphopain Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 33.1kDa
Tag: N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Purity: >85% by SDS-PAGE
Sequence: VPFSCDWRKVASAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP
Target: Cathepsin W (CTSW)



* VAT and and shipping costs not included.
Errors and price changes excepted
Availability
ORDER BY EMAIL
Product Guarantee and Expert Support
BIOZOL