Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1), Unconjugated, E. coli

Catalog Number: BIM-RPC31365
Article Name: Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC31365
Supplier Catalog Number: RPC31365
Alternative Catalog Number: BIM-RPC31365-20UG,BIM-RPC31365-100UG,BIM-RPC31365-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cartilage-linking protein 1, Cartilage-link protein Proteoglycan link protein CRTL1
Recombinant Human Hyaluronan and proteoglycan link protein 1 (HAPLN1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: Hyaluronan and proteoglycan link protein 1 (HAPLN1) . Accession Number: P10915, HAPLN1. Expression Region: 16-354aa. Tag Info: N-terminal 6xHis-SUMO-tagged. Theoretical MW: 51.4kda. Target Synonyms: Cartilage-linking protein 1, Cartilage-link protein Proteoglycan link protein CRTL1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 51.4kDa
Tag: N-Terminal 6xHis-SUMO-Tagged
Purity: >85% by SDS-PAGE
Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKL
Target: Hyaluronan and proteoglycan link protein 1 (HAPLN1)