Human ATP5B protein

Catalog Number: BYT-ORB10177
Article Name: Human ATP5B protein
Biozol Catalog Number: BYT-ORB10177
Supplier Catalog Number: orb10177
Alternative Catalog Number: BYT-ORB10177-20,BYT-ORB10177-100,BYT-ORB10177-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ATP 5B, ATP synthase H+ transporting mitochondrial F1 complex beta polypeptide, ATP synthase subunit beta mitochondrial, ATP synthase subunit beta, mitochondrial, atp5b, ATPB, ATPB_HUMAN, ATPMB, ATPSB, Epididymis secretory protein Li 271, HEL-S-271, Mitochondrial ATP synthase beta subunit, Mitochondrial ATP Synthase Subunit Beta, Mitochondrial ATP synthetase beta subunit
This Human ATP5B protein spans the amino acid sequence from region 48-529aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 53.8 kDa
UniProt: P06576
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 6xHis-taggedExpression Region: 48-529aaSequence Info: FulllengthofmatureproteinGlycerol content: 0.5
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.