Bacterial mdh protein

Catalog Number: BYT-ORB10196
Article Name: Bacterial mdh protein
Biozol Catalog Number: BYT-ORB10196
Supplier Catalog Number: orb10196
Alternative Catalog Number: BYT-ORB10196-20,BYT-ORB10196-100,BYT-ORB10196-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: mdh, BAbS19_I18080, Malate dehydrogenase, EC 1.1.1.37
This Bacterial mdh protein spans the amino acid sequence from region 1-320aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 53.7 kDa
UniProt: B2S881
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Brucella abortus (strain S19)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MARNKIALIGSGMIGGTLAHLAGLKELGDVVLFDIAEGTPQGKGLDIAESSPVDGFDAKFTGANDYAAIEGADVVIVTAGVPRKPGMSRDDLLGINLKVMEQVGAGIKKYAPEAFVICITNPLDAMVWALQKFSGLPAHKVVGMAGVLDSARFRYFLSEEFNVSVEDVTVFVLGGHGDSMVPLARYSTVAGIPLPDLVKMGWTSQDKLDKIIQRTRDGGAEIVGLLKTGSAFYAPAASAIQMAESYLKDKKRVLP
Application Notes: Biological Origin: Brucella abortus (strain S19). Application Notes: Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1-320aaSequence Info: Full LengthGlycerol content: 0.5
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus (strain S19) mdh.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Brucella abortus (strain S19) mdh.