Human HDAC6 protein

Catalog Number: BYT-ORB10396
Article Name: Human HDAC6 protein
Biozol Catalog Number: BYT-ORB10396
Supplier Catalog Number: orb10396
Alternative Catalog Number: BYT-ORB10396-20,BYT-ORB10396-100,BYT-ORB10396-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CPBHM, FLJ16239, HD 6, HD6, HDAC 6, HDAC6, HDAC6_HUMAN, Histone deacetylase 6 (HD6), Histone deacetylase 6, JM 21, JM21, KIAA0901, OTTHUMP00000032398, OTTHUMP00000197663, PPP1R90, Protein phosphatase 1 regulatory subunit 90
This Human HDAC6 protein spans the amino acid sequence from region 1-488aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 70.1 kDa
UniProt: Q9UBN7
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVH
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-488aaSequence Info: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.