Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active)

Catalog Number: BYT-ORB1095868
Article Name: Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active)
Biozol Catalog Number: BYT-ORB1095868
Supplier Catalog Number: orb1095868
Alternative Catalog Number: BYT-ORB1095868-20,BYT-ORB1095868-100,BYT-ORB1095868-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active) spans the amino acid sequence from region 25-110aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 38.7 kDa
UniProt: Q6UW32
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 µg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 µg/ml can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.