Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial (Active)

Catalog Number: BYT-ORB1095872
Article Name: Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial (Active)
Biozol Catalog Number: BYT-ORB1095872
Supplier Catalog Number: orb1095872
Alternative Catalog Number: BYT-ORB1095872-20,BYT-ORB1095872-100,BYT-ORB1095872-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (Neurotrophic tyrosine kinase, receptor-related 1)
This Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial (Active) spans the amino acid sequence from region 30-403aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 44.8 kDa
UniProt: Q01973
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCED
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 µg/mL can bind anti-ROR1 antibody, the EC50 is 0.2450-0.3416 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 µg/ml can bind anti-ROR1 antibody, the EC50 is 0.2450-0.3416 ng/mL.
The purity of ROR1 was greater than 90% as determined by SEC-HPLC