Recombinant Vaccinia virus Protein L1 (L1R), partial

Catalog Number: BYT-ORB1095944
Article Name: Recombinant Vaccinia virus Protein L1 (L1R), partial
Biozol Catalog Number: BYT-ORB1095944
Supplier Catalog Number: orb1095944
Alternative Catalog Number: BYT-ORB1095944-20,BYT-ORB1095944-100,BYT-ORB1095944-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein L1(Virion membrane protein M25)
This Recombinant Vaccinia virus Protein L1 (L1R), partial spans the amino acid sequence from region 2-183aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 21.9 kDa
UniProt: P20540
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Vaccinia virus (strain Copenhagen) (VACV)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
Application Notes: Biological Origin: Vaccinia virus (strain Copenhagen) (VACV). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.