Recombinant Human Receptor-type tyrosine-protein phosphatase-like N (PTPRN), partial

Catalog Number: BYT-ORB1096032
Article Name: Recombinant Human Receptor-type tyrosine-protein phosphatase-like N (PTPRN), partial
Biozol Catalog Number: BYT-ORB1096032
Supplier Catalog Number: orb1096032
Alternative Catalog Number: BYT-ORB1096032-20,BYT-ORB1096032-100,BYT-ORB1096032-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Receptor-type tyrosine-protein phosphatase-like N(R-PTP-N)(Islet cell antigen 512)(ICA 512)(Islet cell autoantigen 3)(PTP IA-2) [Cleaved into, ICA512-N-terminal fragment(ICA512-NTF), ICA512-transmembrane fragment(ICA512-TMF), ICA512-cleaved cytosolic fragment(ICA512-CCF)]
This Recombinant Human Receptor-type tyrosine-protein phosphatase-like N (PTPRN), partial spans the amino acid sequence from region 35-575aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 61.3 kDa
UniProt: Q16849
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VSAHGCLFDRRLCSHLEVCIQDGLFGQCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPEPRPRDRSGLAPKRPGPAGELLLQDIPTGSAPAAQHRLPQPPVGKGGAGASSSLSPLQAELLPPLLEHLLLPPQPPHPSLSYEPALLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.