Recombinant Escherichia phage lambda Capsid decoration protein (D)

Catalog Number: BYT-ORB1096033
Article Name: Recombinant Escherichia phage lambda Capsid decoration protein (D)
Biozol Catalog Number: BYT-ORB1096033
Supplier Catalog Number: orb1096033
Alternative Catalog Number: BYT-ORB1096033-20,BYT-ORB1096033-100,BYT-ORB1096033-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Capsid decoration protein(Auxiliary protein D)(Gene product D)(gpD)(Major capsid protein D)
This Recombinant Escherichia phage lambda Capsid decoration protein (D) spans the amino acid sequence from region 1-110aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 26.9 kDa
UniProt: P03712
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia phage lambda (Bacteriophage lambda)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV
Application Notes: Biological Origin: Escherichia phage lambda (Bacteriophage lambda). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.