Recombinant Enterovirus A71 Genome polyprotein, partial

Catalog Number: BYT-ORB1096064
Article Name: Recombinant Enterovirus A71 Genome polyprotein, partial
Biozol Catalog Number: BYT-ORB1096064
Supplier Catalog Number: orb1096064
Alternative Catalog Number: BYT-ORB1096064-20,BYT-ORB1096064-100,BYT-ORB1096064-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Genome polyprotein [Cleaved into, P3, Protein 3AB, P2, P1, Capsid protein VP0(VP4-VP2), Capsid protein VP4(P1A)(Virion protein 4), Capsid protein VP2(P1B)(Virion protein 2), Capsid protein VP3(P1C)(Virion protein 3), Capsid protein VP1(P1D)(Virion protein 1), Protease 2A(P2A)(EC 3.4.22.29)(Picornain 2A)(Protein 2A), Protein 2B(P2B), Protein 2C(P2C)(EC 3.6.1.15), Protein 3A(P3A), Viral protein genome-linked(VPg)(Protein 3B)(P3B), Protein 3CD(EC 3.4.22.28), Protease 3C(P3C), RNA-directed RNA polymerase(RdRp)(EC 2.7.7.48)(3D polymerase)(3Dpol)(Protein 3D)(3D)]
This Recombinant Enterovirus A71 Genome polyprotein, partial spans the amino acid sequence from region 1441-1497aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 6.5 kDa
UniProt: F6KTB0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Enterovirus A71
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR
Application Notes: Biological Origin: Enterovirus A71. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.