Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial (Active)

Catalog Number: BYT-ORB1096082
Article Name: Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial (Active)
Biozol Catalog Number: BYT-ORB1096082
Supplier Catalog Number: orb1096082
Alternative Catalog Number: BYT-ORB1096082-20,BYT-ORB1096082-100,BYT-ORB1096082-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Osteoclast differentiation factor, ODF, Osteoprotegerin ligand, OPGL, Receptor activator of nuclear factor kappa-B ligand, RANKL, TNF-related activation-induced cytokine, TRANCE, CD254
This Recombinant Human Tumor necrosis factor ligand superfamily member 11 (TNFSF11), partial spans the amino acid sequence from region 63-244aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 22.7 kDa
UniProt: O14788
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF11 at 2 µg/mL can bind Human TNFRSF11B. The EC50 is 4.514-5.152 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.