Recombinant Rat Serine protease inhibitor A3K (Serpina3k)

Catalog Number: BYT-ORB1096518
Article Name: Recombinant Rat Serine protease inhibitor A3K (Serpina3k)
Biozol Catalog Number: BYT-ORB1096518
Supplier Catalog Number: orb1096518
Alternative Catalog Number: BYT-ORB1096518-1,BYT-ORB1096518-100,BYT-ORB1096518-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CPI-21 (Contrapsin-like protease inhibitor 1) (GHR-P63) (Growth hormone-regulated proteinase inhibitor)(Kallikrein-binding protein) (KBP) (SPI-2.3) (Serine protease inhibitor 2) (SPI-2) (Thyroid hormone-regulated protein)
This Recombinant Rat Serine protease inhibitor A3K (Serpina3k) spans the amino acid sequence from region 21-416aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 52.0 kDa
UniProt: P05545
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DGILGRDTLPHEDQGKGRQLHSLTLASINTDFTLSLYKKLALRNPDKNVVFSPLSISAALAILSLGAKDSTMEEILEVLKFNLTEITEEEIHQGFGHLLQRLSQPEDQAEINTGSALFIDKEQPILSEFQEKTRALYQAEAFVADFKQCNEAKKFINDYVSNQTQGKIAELFSELDERTSMVLVNYLLFKGKWKVPFNPNDTFESEFYLDEKRSVKVPMMKIKDLTTPYIRDEELSCSVLELKYTGNASALFILP
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.