This Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b) spans the amino acid sequence from region 1-45aa. Purity: Greater than 90% as determined by SDS-PAGE.
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source:
Bovine coronavirus (strain LY-138) (BCoV) (BCV)
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Sequence:
MPMATTIDGTDYTNIMPSTVSTTVYLGGSIGIDTSTTGFTCFSWY
Application Notes:
Biological Origin: Bovine coronavirus (strain LY-138) (BCoV) (BCV). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
* VAT and and shipping costs not included. Errors and price changes excepted