Recombinant Bovine coronavirus Non-structural protein 2a (2a)

Catalog Number: BYT-ORB1096677
Article Name: Recombinant Bovine coronavirus Non-structural protein 2a (2a)
Biozol Catalog Number: BYT-ORB1096677
Supplier Catalog Number: orb1096677
Alternative Catalog Number: BYT-ORB1096677-1,BYT-ORB1096677-100,BYT-ORB1096677-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ns2a, 32 kDa accessory protein, 32 kDa non-structural protein, ns2
This Recombinant Bovine coronavirus Non-structural protein 2a (2a) spans the amino acid sequence from region 1-278aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 33.7 kDa
UniProt: Q91A27
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAVAYADKPNHFINFPLTQFQGFVLNYKGLQFQLLDEGVDCKIQTAPHISLAMLDIQPEDYRSVDVAIQEVIDDMHWGEGFQIKFENPHILGRCIVLDVKGVEELHDDLVNYIRDKGCVADQSRKWIGHCTIAQLTDAALSIKENVDFINNMQFNYKITINPSSPARLEIVKLGAERKDGFYETIASHWMGIRFEYNPPTDKLAMIMGYCCLEVVRKELEEGDLPENDDDAWFKLSYHYENNSWFFRHVYRKSSY
Application Notes: Biological Origin: Bovine coronavirus (strain 98TXSF-110-ENT) (BCoV-ENT) (BCV). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.