Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial

Catalog Number: BYT-ORB1096685
Article Name: Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial
Biozol Catalog Number: BYT-ORB1096685
Supplier Catalog Number: orb1096685
Alternative Catalog Number: BYT-ORB1096685-1,BYT-ORB1096685-100,BYT-ORB1096685-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (S glycoprotein)(E2)(Peplomer protein)
This Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial spans the amino acid sequence from region 306-527aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 27.2 kDa
UniProt: P59594
Buffer: Lyophilized from a 0.2 µm sterile filtered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0
Source: Severe acute respiratory syndrome coronavirus (SARS-CoV)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
Application Notes: Biological Origin: Severe acute respiratory syndrome coronavirus (SARS-CoV). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.