Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial

Catalog Number: BYT-ORB1096694
Article Name: Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial
Biozol Catalog Number: BYT-ORB1096694
Supplier Catalog Number: orb1096694
Alternative Catalog Number: BYT-ORB1096694-1,BYT-ORB1096694-100,BYT-ORB1096694-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: S glycoprotein, E2, Peplomer protein
This Recombinant Human Novel Coronavirus Spike glycoprotein(S)(N501Y,P681H),partial spans the amino acid sequence from region 16-685aa(N501Y,P681H). Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 77.8 kDa
UniProt: P0DTC2
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYL
Application Notes: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.