Escherichia coli malE&Human OPA3 Protein

Catalog Number: BYT-ORB1477189
Article Name: Escherichia coli malE&Human OPA3 Protein
Biozol Catalog Number: BYT-ORB1477189
Supplier Catalog Number: orb1477189
Alternative Catalog Number: BYT-ORB1477189-1,BYT-ORB1477189-100,BYT-ORB1477189-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This product spans the sequence region M+27-396(malE) & 103-179(OPA3). Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 60.9 kDa
UniProt: Q9H6K4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQP
Application Notes: Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.