CCL17 Protein

Catalog Number: BYT-ORB1477274
Article Name: CCL17 Protein
Biozol Catalog Number: BYT-ORB1477274
Supplier Catalog Number: orb1477274
Alternative Catalog Number: BYT-ORB1477274-1,BYT-ORB1477274-100,BYT-ORB1477274-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (CC chemokine TARC)(Small-inducible cytokine A17)(Thymus and activation-regulated chemokine)
This CCL17 Protein spans the amino acid sequence from region 24-99aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 10.1 kDa
UniProt: Q95N01
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Canis lupus familiaris (Dog) (Canis familiaris)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES
Application Notes: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.