Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH)

Catalog Number: BYT-ORB1785258
Article Name: Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH)
Biozol Catalog Number: BYT-ORB1785258
Supplier Catalog Number: orb1785258
Alternative Catalog Number: BYT-ORB1785258-1,BYT-ORB1785258-100,BYT-ORB1785258-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (19 kDa lipoprotein antigen)(22 kDa lipoprotein antigen)(Mi22 antigen)(Putative transporter LpqH)
This Recombinant Mycobacterium intracellulare Lipoprotein lpqH (lpqH) spans the amino acid sequence from region 22-162aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.6 kDa
UniProt: P31502
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mycobacterium intracellulare
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CSGGNKSGTSASSSANSSGTTRRLAPGAAGTKVTIDGKDQNVSGSVVCTNAGGTINIAIGGAATGIAAVLSDGNPPQVKSVGLGNVNGVTLGYTSGTGQGNATASKDGNSYKISGTATGVDMANPMQPVNKPFEINVTCNS
Application Notes: Biological Origin: Mycobacterium intracellulare. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.