Recombinant Human Placenta growth factor (PGF) (Active)

Catalog Number: BYT-ORB1785323
Article Name: Recombinant Human Placenta growth factor (PGF) (Active)
Biozol Catalog Number: BYT-ORB1785323
Supplier Catalog Number: orb1785323
Alternative Catalog Number: BYT-ORB1785323-1,BYT-ORB1785323-100,BYT-ORB1785323-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Placenta growth factor, PlGF, PGF, PGFL, PLGF
This Recombinant Human Placenta growth factor (PGF), partial spans the amino acid sequence from region 19-170aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 45.1 kDa
UniProt: P49763
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 µg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.