Recombinant Pseudomonas aeruginosa Elastase (lasB)

Catalog Number: BYT-ORB1785374
Article Name: Recombinant Pseudomonas aeruginosa Elastase (lasB)
Biozol Catalog Number: BYT-ORB1785374
Supplier Catalog Number: orb1785374
Alternative Catalog Number: BYT-ORB1785374-1,BYT-ORB1785374-100,BYT-ORB1785374-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (Neutral metalloproteinase)(PAE)(Pseudolysin)
This Recombinant Pseudomonas aeruginosa Elastase (lasB), partial spans the amino acid sequence from region 198-498aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 35.2 kDa
UniProt: P14756
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDAN
Application Notes: Biological Origin: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.