Recombinant Human HLA-DRB1&HLA-DRA Heterodimer Protein-VLPs

Catalog Number: BYT-ORB1881838
Article Name: Recombinant Human HLA-DRB1&HLA-DRA Heterodimer Protein-VLPs
Biozol Catalog Number: BYT-ORB1881838
Supplier Catalog Number: orb1881838
Alternative Catalog Number: BYT-ORB1881838-1,BYT-ORB1881838-100,BYT-ORB1881838-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Human HLA-DRB1&HLA-DRA Heterodimer Protein-VLPs spans the amino acid sequence from region 30-266aa&26-254aa. Purity: The purity information is not available for VLPs proteins.
Molecular Weight: 28.3 kDa&27.0 kDa
UniProt: D7RIG5
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Source: Homo sapiens (Human)
Purity: The purity information is not available for VLPs proteins.
Form: Lyophilized powder
Sequence: GDTQPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTELGRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVMSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS&IKEEHVIIQAEFY
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 95% as determined by SEC-HPLC