Recombinant Human Serotransferrin (TF) (Active)

Catalog Number: BYT-ORB1881868
Article Name: Recombinant Human Serotransferrin (TF) (Active)
Biozol Catalog Number: BYT-ORB1881868
Supplier Catalog Number: orb1881868
Alternative Catalog Number: BYT-ORB1881868-1,BYT-ORB1881868-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Transferrin,Beta-1 metal-binding globulin,Siderophilin,TF ,PRO1400
This Recombinant Human Serotransferrin (TF) (Active) spans the amino acid sequence from region 20-698aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 104.1 kDa
UniProt: P02787
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARS
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TFRC at 2 µg/mL can bind Human TF. The EC50 is 58.72-77.84 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized TFRC at 2µg/mL can bind Human TF, the EC50 is 58.72-77.84 ng/mL.