Recombinant Human Neuropilin-1 (NRP1) (V179A)

Catalog Number: BYT-ORB1881869
Article Name: Recombinant Human Neuropilin-1 (NRP1) (V179A)
Biozol Catalog Number: BYT-ORB1881869
Supplier Catalog Number: orb1881869
Alternative Catalog Number: BYT-ORB1881869-1,BYT-ORB1881869-100,BYT-ORB1881869-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (Vascular endothelial cell growth factor 165 receptor)(CD antigen CD304)
This Recombinant Human Neuropilin-1 (NRP1) (V179A) spans the amino acid sequence from region 22-644aa(V179A). Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 98.8 kDa
UniProt: O14786
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCM
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of NRP1 was greater than 90% as determined by SEC-HPLC