Recombinant Human Type-2 angiotensin II receptor (AGTR2)-VLPs

Catalog Number: BYT-ORB1881871
Article Name: Recombinant Human Type-2 angiotensin II receptor (AGTR2)-VLPs
Biozol Catalog Number: BYT-ORB1881871
Supplier Catalog Number: orb1881871
Alternative Catalog Number: BYT-ORB1881871-1,BYT-ORB1881871-100,BYT-ORB1881871-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: (Angiotensin II type-2 receptor)(AT2 receptor)
This Recombinant Human Type-2 angiotensin II receptor (AGTR2)-VLPs spans the sequence from region 1-363aa.
Molecular Weight: 42.6 kDa
UniProt: P50052
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Source: Homo sapiens (Human)
Form: Lyophilized powder
Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 95% as determined by SEC-HPLC