Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), partial (Active)

Catalog Number: BYT-ORB1882054
Article Name: Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), partial (Active)
Biozol Catalog Number: BYT-ORB1882054
Supplier Catalog Number: orb1882054
Alternative Catalog Number: BYT-ORB1882054-1,BYT-ORB1882054-100,BYT-ORB1882054-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD158K,NKAT4
This Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2), partial (Active) spans the amino acid sequence from region 22-340aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36.4 kDa
UniProt: P43630
Buffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTF
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human KIR3DL2 at 2 µg/mL can bind Anti-KIR3DL2 recombinant antibody, the EC50 is 14.18-23.93 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human KIR3DL2 at 2µg/mL can bind Anti-KIR3DL2 recombinant antibody, the EC50 is 14.18-23.93 ng/mL.
The purity of KIR3DL2 was greater than 95% as determined by SEC-HPLC