KLF6 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133213
Article Name: KLF6 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133213
Supplier Catalog Number: orb2133213
Alternative Catalog Number: BYT-ORB2133213-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLF6
Conjugation: HRP
Alternative Names: GBF, ZF9, BCD1, CBA1, CPBP, PAC1, ST12, COPEB
KLF6 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 001291
UniProt: Q99612
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHF