KLF6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2133214
Article Name: KLF6 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133214
Supplier Catalog Number: orb2133214
Alternative Catalog Number: BYT-ORB2133214-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KLF6
Conjugation: FITC
Alternative Names: GBF, ZF9, BCD1, CBA1, CPBP, PAC1, ST12, COPEB
KLF6 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 001291
UniProt: Q99612
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHF