Htr3a Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133234
Article Name: Htr3a Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133234
Supplier Catalog Number: orb2133234
Alternative Catalog Number: BYT-ORB2133234-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Conjugation: HRP
Alternative Names: 5HT3, Htr3, 5-HT3, 5-HT3A
Htr3a Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 077370
UniProt: P35563
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PATAIGTPLIGVYFVVCMALLVISLAETIFIVQLVHKQDLQRPVPDWLRH