TRPM3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2133238
Article Name: TRPM3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133238
Supplier Catalog Number: orb2133238
Alternative Catalog Number: BYT-ORB2133238-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM3
Conjugation: FITC
Alternative Names: GON-2, MLSN2, LTRPC3
TRPM3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 188kDa
NCBI: 001007472
UniProt: Q9HCF6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD