CACNB2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133243
Article Name: CACNB2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133243
Supplier Catalog Number: orb2133243
Alternative Catalog Number: BYT-ORB2133243-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNB2
Conjugation: HRP
Alternative Names: CAB2, MYSB, CAVB2, CACNLB2
CACNB2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 71
NCBI: 963891
UniProt: Q6TME3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SRKSTPPSSGAKSADEQDQWKTAGLFWRFTTEHTPPYDVVPSMRPVVLVG