TPTE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133276
Article Name: TPTE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133276
Supplier Catalog Number: orb2133276
Alternative Catalog Number: BYT-ORB2133276-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPTE
Conjugation: HRP
Alternative Names: CT44, PTEN2
TPTE Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 954869
UniProt: P56180
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: IQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGLPLYDDVKVQFFY