CACNB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133285
Article Name: CACNB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133285
Supplier Catalog Number: orb2133285
Alternative Catalog Number: BYT-ORB2133285-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CACNB1
Conjugation: HRP
Alternative Names: CAB1, CCHLB1, CACNLB1
CACNB1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 954855
UniProt: Q02641
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP