GABRG2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133291
Article Name: GABRG2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133291
Supplier Catalog Number: orb2133291
Alternative Catalog Number: BYT-ORB2133291-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABRG2
Conjugation: HRP
Alternative Names: CAE2, ECA2, FEB8, DEE74, EIEE74, GEFSP3
GABRG2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 944493
UniProt: P18507
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR