GABRG2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2133292
Article Name: GABRG2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133292
Supplier Catalog Number: orb2133292
Alternative Catalog Number: BYT-ORB2133292-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GABRG2
Conjugation: FITC
Alternative Names: CAE2, ECA2, FEB8, DEE74, EIEE74, GEFSP3
GABRG2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 944493
UniProt: P18507
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR