SCN5A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2133304
Article Name: SCN5A Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133304
Supplier Catalog Number: orb2133304
Alternative Catalog Number: BYT-ORB2133304-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SCN5A
Conjugation: FITC
Alternative Names: HB1, HB2, HH1, IVF, VF1, HBBD, ICCD, LQT3, SSS1, CDCD2, CMD1E, CMPD2, PFHB1, Nav1.5
SCN5A Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 222kDa
NCBI: 000326
UniProt: Q8IZC9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM