ACCN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133318
Article Name: ACCN1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133318
Supplier Catalog Number: orb2133318
Alternative Catalog Number: BYT-ORB2133318-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACCN1
Conjugation: HRP
Alternative Names: ACCN, BNC1, MDEG, ACCN1, BNaC1, ASIC2a, hBNaC1
ACCN1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 001085
UniProt: Q16515
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA