HTR3E Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2133325
Article Name: HTR3E Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133325
Supplier Catalog Number: orb2133325
Alternative Catalog Number: BYT-ORB2133325-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HTR3E
Conjugation: FITC
Alternative Names: 5-HT3E, 5-HT3-E, 5-HT3c1
HTR3E Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 872395
UniProt: A5X5Y0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG