KCTD13 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133333
Article Name: KCTD13 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133333
Supplier Catalog Number: orb2133333
Alternative Catalog Number: BYT-ORB2133333-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD13
Conjugation: HRP
Alternative Names: PDIP1, FKSG86, BACURD1, POLDIP1, hBACURD1
KCTD13 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 849194
UniProt: Q8WZ19
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE