KCTD13 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2133334
Article Name: KCTD13 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133334
Supplier Catalog Number: orb2133334
Alternative Catalog Number: BYT-ORB2133334-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD13
Conjugation: FITC
Alternative Names: PDIP1, FKSG86, BACURD1, POLDIP1, hBACURD1
KCTD13 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 849194
UniProt: Q8WZ19
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE